PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT33527
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 335aa    MW: 36321.3 Da    PI: 6.8442
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT33527genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.82.9e-142266347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT+eE++l++ + k++G g+W+ I+r   + Rt+ q+ s+ qky
         EMT33527 22 PWTEEEHKLFLMGLKKYGRGDWRNISRNYVTSRTPTQVASHAQKY 66
                     8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.5821571IPR017930Myb domain
SuperFamilySSF466891.94E-171771IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-171869IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.607.5E-121965IPR009057Homeodomain-like
SMARTSM007171.2E-121969IPR001005SANT/Myb domain
PfamPF002491.1E-112266IPR001005SANT/Myb domain
CDDcd001674.43E-112267No hitNo description
SMARTSM007173.8256308IPR001005SANT/Myb domain
SuperFamilySSF466891.15E-6258302IPR009057Homeodomain-like
PROSITE profilePS500904.855258302IPR017877Myb-like domain
CDDcd001670.00661259302No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MAAGGNGKRG RGADQERKKG VPWTEEEHKL FLMGLKKYGR GDWRNISRNY VTSRTPTQVA  60
SHAQKYFIRL NSGGKDKRRS SIHDITTVNI PDDDHASNTN PSPSPPSALT ATSSAPEQFG  120
ALVDSKPPPP LGGNHRFMPA HLCNAASSSL SVDQGLLGAA AAQPPSEKAV SSSSVHEEGG  180
ENHTTSHVLL QESASVTFED SGIWVFFSFD KEARTPACAS TYAHNHTYQR FMGDRVKGNP  240
SSFCFLRTPK GDEWSGGGAW SLEENKLFKE ALVRVDGDVA DRWELVASLP SGKTVADVMM  300
HYDDPGIDVC FIEAELVPFP HYNAGDSSSA FRKVG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519360.0JF951936.1 Triticum aestivum clone TaMYB53 MYB-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006654489.12e-68PREDICTED: transcription factor DIVARICATA-like
TrEMBLN1R5D10.0N1R5D1_AEGTA; Myb-like protein J
STRINGOB05G26340.17e-68(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22743796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-44MYB family protein